Advertisement is the 0:th largest website within the world. The website is created in 03/03/2000, owned by unavailable person, currently located in United States and is running on IP registered by MARKMONITOR INC. network. This site not uses Javascript for user interaction. This site uses CSS to manage the site layout. This site is running on the nginx webserver. The server side programming lanquage of the site is not detected. Google Pagerank is 0 and it's domain is Commercial. estimated worth is $0.00, with 0 estimated visites per day and ad revenue of $ 0.00.

Title: Search Engine Marketing Tips on

Description: Tips To Help Grow Your SEO Efforts

Keywords: Engine Marketing Tips Grow Seo Efforts Nginx Gmt Charset

Created: 03/03/2000

Expires: 03/03/2020

Owner: unavailable

Hosted in: United States

Host IP:


Domain Suffix: com

Domain Archive: in the past

Alexa Rank: #0

Google Page Rank: 0

HOSTCLASSTYPETTLDATA IN A 151 ip: IN A 151 ip: IN CNAME 14400 target:

Server Name:

Server Type: nginx

Server Side Language: unavailable

Javascript Usage: no

CSS Usage: yes

RSS Usage: no

Google AdSense Usage: no

Additional technologies usage: WordPress - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Seo 25 2.69
Business 19 2.04
National 13 1.4
Marketing 12 1.29
Engine 10 1.07
People 9 0.97
Businesses 8 0.86
Grow 8 0.86
Tips 7 0.75
Area 7 0.75
Customers 6 0.64
Way 5 0.54
Should 5 0.54
Advantage 4 0.43
Effective 4 0.43
Important 3 0.32
Optimization 3 0.32
Onto 3 0.32
Specific 3 0.32
Target 3 0.32
Social 3 0.32

We are absolutely certain that every one is able to earn money from his website, Therefor we will display a short estimated numbers that might be achievable through dedication and seriousness work on your website.

Our estimations point that your Website Value is $0.00, Your Daily Visitors could be in the area of 0 per day and your potential Daily Revenues could be around $0.00.

Server Country Code: US

Server Country Name: United States

Server City Name: San Francisco

Server Region Name: CA

Server Zip Code: 94110

Server Latitude: 37.748401641846

Server Longitude: -122.4156036377

From - to Netname Country Admin Tech Status - IANA-BLK EU # Country field is actually a DUMY-RIPE DUMY-RIPE ALLOCATED UNSPEC - EU-ZZ-192 EU # Country is really world wid DUMY-RIPE DUMY-RIPE ALLOCATED UNSPEC - NON-RIPE-NCC-MANAGED-ADDRESS-BLOCK EU # Country is really world wid DUMY-RIPE DUMY-RIPE ALLOCATED UNSPEC
Address 11000000.00000000.01001110.00001100
Netmask = 24 11111111.11111111.11111111.00000000
Wildcard 00000000.00000000.00000000.11111111
Network 11000000.00000000.01001110.00000000
HostMin 11000000.00000000.01001110.00000001
HostMax 11000000.00000000.01001110.11111110
Broadcast 11000000.00000000.01001110.11111111
Hosts/Net 254 Class C

westsearchenginemarketingtips.wordpress, besfsearchenginemarketingtips.wordpress, besjsearchenginemarketingtips.wordpress, bestsearshenginemarketingtips.wordpress, bestsearcnenginemarketingtips.wordpress, bestsearchfnginemarketingtips.wordpress, bestsearchnnginemarketingtips.wordpress, bestsearcheiginemarketingtips.wordpress, bestsearchenzinemarketingtips.wordpress, bestsearchenginrmarketingtips.wordpress, bestsearchengineaarketingtips.wordpress, bestsearchenginemwrketingtips.wordpress, bestsearchenginemarkelingtips.wordpress, bestsearchenginemarketimgtips.wordpress, bestsearchenginemarketingqips.wordpress, bestsearchenginemarketingtijs.wordpress, bestsearchenginemarketingtipq.wordpress, bestsearchenginemarketingtips.wprdpress, bestsearchenginemarketingtips.wowdpress, bestsearchenginemarketingtips.worhpress, bestsearchenginemarketingtips.worlpress, bestsearchenginemarketingtips.wordcress, bestsearchenginemarketingtips.wordiress, bestsearchenginemarketingtips.wordprlss, bestsearchenginemarketingtips.wordpresj, bestsearchenginemarketingtips.wordprest, bestsearchenginemarketingtip.swordpress, besttsearchenginemarketingtips.wordpress, besxtsearchenginemarketingtips.wordpress, bestswearchenginemarketingtips.wordpress, bestseacrchenginemarketingtips.wordpress, bestsearckhenginemarketingtips.wordpress, bestsearchennginemarketingtips.wordpress, bestsearchengeinemarketingtips.wordpress, bestsearchenghinemarketingtips.wordpress, bestsearchenginremarketingtips.wordpress, bestsearchenginemarkaetingtips.wordpress, bestsearchenginemarkhetingtips.wordpress, bestsearchenginemarkewtingtips.wordpress, bestsearchenginemarketmingtips.wordpress, bestsearchenginemarketqingtips.wordpress, bestsearchenginemarketingtrips.wordpress, bestsearchenginemarketingtyips.wordpress, bestsearchenginemarketingtipws.wordpress, bestsearchenginemarketingtips.weordpress, bestsearchenginemarketingtips.woredpress, bestsearchenginemarketingtips.wordnpress, bestsearchenginemarketingtips.wordpreess, bestsearchenginemarketingtips.wordpreuss, bestsearchenginemarketingtips.wordpressi,

נקדאדקשרביקמעןמקצשרלקאןמעאןפדץ'םרגפרקדד, иуыеыуфксрутпштуьфклуештпешзыюцщквзкуыы, لثسفسثشقؤاثالهاثىشقنثفهالفهحسوصخقيحقثسس, феяшяеьиъгехжсхепьинешсхжшсзялудиазиеяя, veqtqe*rxgebfiben*rjetibftipq;zorspreqq, bestsearchenginemarketingtips.wordpress, μεστσεαρβηε,γι,ε.αρκετι,γτιπσςορδπρεσσ, נקדאדקשרביקמעןמקצשרלקאןמעאןפדץ'םרגפרקדדץבםצ, иуыеыуфксрутпштуьфклуештпешзыюцщквзкуыыюсщь, لثسفسثشقؤاثالهاثىشقنثفهالفهحسوصخقيحقثسسوؤخى, феяшяеьиъгехжсхепьинешсхжшсзялудиазиеяялъдп, veqtqe*rxgebfiben*rjetibftipq;zorspreqq;xon,, μεστσεαρβηε,γι,ε.αρκετι,γτιπσςορδπρεσσβο.

Domain Name:
Registry Domain ID: 21242797_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-01-13T14:26:51-0800
Creation Date: 2000-03-03T04:13:23-0800
Registrar Registration Expiration Date: 2020-03-03T04:13:23-0800
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: ******
Registrar Abuse Contact Phone: +1.2083895740
Domain Status: clientUpdateProhibited (
Domain Status: clientTransferProhibited (
Domain Status: clientDeleteProhibited (
Domain Status: serverUpdateProhibited (
Domain Status: serverTransferProhibited (
Domain Status: serverDeleteProhibited (
Registry Registrant ID:
Registrant Name: Domain Admin
Registrant Organization: Automattic, Inc.
Registrant Street: 60 29th Street, #343
Registrant City: San Francisco
Registrant State/Province: CA
Registrant Postal Code: 94110
Registrant Country: US
Registrant Phone: +1.8772738550
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: ******
Registry Admin ID:
Admin Name: Domain Admin
Admin Organization: Automattic, Inc.
Admin Street: 60 29th Street, #343
Admin City: San Francisco
Admin State/Province: CA
Admin Postal Code: 94110
Admin Country: US
Admin Phone: +1.8772738550
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: ******
Registry Tech ID:
Tech Name: Domain Admin
Tech Organization: Automattic, Inc.
Tech Street: 60 29th Street, #343
Tech City: San Francisco
Tech State/Province: CA
Tech Postal Code: 94110
Tech Country: US
Tech Phone: +1.8772738550
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: ******
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
>>> Last update of WHOIS database: 2017-06-21T15:58:03-0700 <<<

The Data in's WHOIS database is provided by for
information purposes, and to assist persons in obtaining information about or
related to a domain name registration record. does not guarantee
its accuracy. By submitting a WHOIS query, you agree that you will use this Data
only for lawful purposes and that, under no circumstances will you use this Data to:
(1) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via e-mail (spam); or
(2) enable high volume, automated, electronic processes that apply to (or its systems). reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by this policy.

MarkMonitor is the Global Leader in Online Brand Protection.

MarkMonitor Domain Management(TM)
MarkMonitor Brand Protection(TM)
MarkMonitor AntiPiracy(TM)
MarkMonitor AntiFraud(TM)
Professional and Managed Services

Visit MarkMonitor at
Contact us at +1.8007459229
In Europe, at +44.02032062220

For more information on Whois status codes, please visit